PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603906.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 245aa    MW: 29301.6 Da    PI: 7.5028
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603906.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66e-181158148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEde+lv+ v++lG ++W++ ar  g++R++k+c++rw +yl
   XP_013603906.1 11 RGPWLEEEDERLVKFVTLLGERRWDSLARVSGLKRSGKSCRLRWMNYL 58
                     89********************************************97 PP

2Myb_DNA-binding54.13.5e-1764108147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++++eE+ ++ +++ q+G++ W++Iar+++ gRt++++k++++++
   XP_013603906.1  64 RGPMSQEEETIIFQLHSQWGNK-WSKIARRLP-GRTDNEVKNYYRTH 108
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.346662IPR017930Myb domain
SuperFamilySSF466891.68E-279105IPR009057Homeodomain-like
SMARTSM007171.1E-131060IPR001005SANT/Myb domain
PfamPF002491.6E-141158IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-201265IPR009057Homeodomain-like
CDDcd001671.56E-81358No hitNo description
SMARTSM007172.2E-1663111IPR001005SANT/Myb domain
PROSITE profilePS5129420.27363113IPR017930Myb domain
PfamPF002498.5E-1564108IPR001005SANT/Myb domain
CDDcd001672.01E-966109No hitNo description
Gene3DG3DSA:1.10.10.602.9E-2466113IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDYKKEETLR RGPWLEEEDE RLVKFVTLLG ERRWDSLARV SGLKRSGKSC RLRWMNYLNP  60
SLKRGPMSQE EETIIFQLHS QWGNKWSKIA RRLPGRTDNE VKNYYRTHFR KKLEAQNYDK  120
IIDWRKNPGE ELFHKYKETE IAWTRTTTQE HGFDKPVKES KQKNMESDKE TNGGICERES  180
FGVMNSPYEN RISDWISEIS TDRSDANFLE DRTSSSSENN ININVGSWWF QETRDFEEFS  240
CSLWS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A2e-2891132105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892691e-152AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence.
GenBankAC1895021e-152AC189502.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB087M20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603906.10.0PREDICTED: transcription factor MYB59
TrEMBLA0A078C9Q60.0A0A078C9Q6_BRANA; BnaC08g24310D protein
TrEMBLA0A0D3DSP90.0A0A0D3DSP9_BRAOL; Uncharacterized protein
STRINGBra006977.1-P1e-154(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM113972533
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.11e-135myb domain protein 27